PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.1G007200.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 331aa    MW: 36465.7 Da    PI: 5.1386
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.1G007200.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.62.5e-172874148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg+W++eE e+l++ v  + +++W++Iar ++ gR++kqc++rw  yl
  Sevir.1G007200.3.p 28 RGAWSQEENEILIQMVDAHSSKDWSSIARAVP-GRSRKQCRDRWTHYL 74
                        89******************************.***********9886 PP

2Myb_DNA-binding40.75.5e-1381121244
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                         ++W+++E+  l++a+k +G++ W   a+ ++ gRt+k +k++w
  Sevir.1G007200.3.p  81 MPWSEQEEIDLIRAHKIHGNK-WCELAKFFP-GRTGKAIKNYW 121
                         68*******************.*********.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.3352378IPR017930Myb domain
SuperFamilySSF466897.49E-2826121IPR009057Homeodomain-like
SMARTSM007172.2E-152776IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-222981IPR009057Homeodomain-like
CDDcd001676.62E-143074No hitNo description
PfamPF139215.5E-173191No hitNo description
SMARTSM007176.4E-1279127IPR001005SANT/Myb domain
PROSITE profilePS5129414.54182129IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-1982129IPR009057Homeodomain-like
CDDcd001671.20E-1182121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MFQHDEPLQA SEYFDDEEPE GTVSFKRRGA WSQEENEILI QMVDAHSSKD WSSIARAVPG  60
RSRKQCRDRW THYLDPAVNQ MPWSEQEEID LIRAHKIHGN KWCELAKFFP GRTGKAIKNY  120
WTGAMKKKIK SNLGSGSPEQ LSPCPNDSLI PVGRDSTATS SQDSSNNIPI SSADLPVRLK  180
SKHGLTEACR NACTLKEKGP DSIHDEGSIP HSVNVSQMVD GRTVGSSLHI LTEEKLVSPL  240
SSVDEKVSCV AANSPKPLKE EESTNFLEIP PALSFQSSNV HSDAICSSAD PESRQLHLAS  300
IADLLDMSYC ESLMVIAPDS TNDEDFKLGM *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C4e-29281294105C-Myb DNA-Binding Domain
1mse_C4e-29281294105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004952183.11e-98PREDICTED: myb-related protein 3R-1-like
TrEMBLK3YUP10.0K3YUP1_SETIT; Uncharacterized protein
STRINGSi017987m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.12e-40myb domain protein 3r-4